TMEM143 polyclonal antibody
  • TMEM143 polyclonal antibody

TMEM143 polyclonal antibody

Ref: AB-PAB20729
TMEM143 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM143.
Información adicional
Size 100 uL
Gene Name TMEM143
Gene Alias FLJ10922
Gene Description transmembrane protein 143
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MWNPREPRDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAEKAALEAFSAHVDFCTLFHYHQILARLQALYDPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLLAQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQYV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM143.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55260
Iso type IgG

Enviar un mensaje


TMEM143 polyclonal antibody

TMEM143 polyclonal antibody