LOC116236 polyclonal antibody
  • LOC116236 polyclonal antibody

LOC116236 polyclonal antibody

Ref: AB-PAB20728
LOC116236 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LOC116236.
Información adicional
Size 100 uL
Gene Name LOC116236
Gene Alias -
Gene Description hypothetical protein LOC116236
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TALEDTVDTSRLFRSRSLREFEEALFCHTKSFPISWDAYWDRNDPLRDVDEAAVPVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPAWSHEVILESFRALTEFFRTEERIKGLSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LOC116236.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116236
Iso type IgG

Enviar un mensaje


LOC116236 polyclonal antibody

LOC116236 polyclonal antibody