KIAA0513 polyclonal antibody
  • KIAA0513 polyclonal antibody

KIAA0513 polyclonal antibody

Ref: AB-PAB20724
KIAA0513 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA0513.
Información adicional
Size 100 uL
Gene Name KIAA0513
Gene Alias -
Gene Description KIAA0513
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PVGSLIDFGPEAPTSSPLEAPPPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA0513.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9764
Iso type IgG

Enviar un mensaje


KIAA0513 polyclonal antibody

KIAA0513 polyclonal antibody