TMEM194A polyclonal antibody
  • TMEM194A polyclonal antibody

TMEM194A polyclonal antibody

Ref: AB-PAB20720
TMEM194A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM194A.
Información adicional
Size 100 uL
Gene Name TMEM194A
Gene Alias DKFZp686N1768|KIAA0286|TMEM194
Gene Description transmembrane protein 194A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM194A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23306
Iso type IgG

Enviar un mensaje


TMEM194A polyclonal antibody

TMEM194A polyclonal antibody