OPALIN polyclonal antibody
  • OPALIN polyclonal antibody

OPALIN polyclonal antibody

Ref: AB-PAB20717
OPALIN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OPALIN.
Información adicional
Size 100 uL
Gene Name OPALIN
Gene Alias HTMP10|TMEM10|TMP10
Gene Description oligodendrocytic myelin paranodal and inner loop protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OPALIN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 93377
Iso type IgG

Enviar un mensaje


OPALIN polyclonal antibody

OPALIN polyclonal antibody