C12orf70 polyclonal antibody
  • C12orf70 polyclonal antibody

C12orf70 polyclonal antibody

Ref: AB-PAB20716
C12orf70 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C12orf70.
Información adicional
Size 100 uL
Gene Name C12orf70
Gene Alias -
Gene Description chromosome 12 open reading frame 70
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LKKKVIERLEDLCKNVELLSAKLRMYQMEAEDTDSHSSEEIDTEEMEALLPQAPASFLVQKSPPRNTAWKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C12orf70.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 341346
Iso type IgG

Enviar un mensaje


C12orf70 polyclonal antibody

C12orf70 polyclonal antibody