ENTPD7 polyclonal antibody
  • ENTPD7 polyclonal antibody

ENTPD7 polyclonal antibody

Ref: AB-PAB20714
ENTPD7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ENTPD7.
Información adicional
Size 100 uL
Gene Name ENTPD7
Gene Alias DKFZp667O124|FLJ30978|FLJ31830|FLJ41522|FLJ95364|LALP1|MGC141913|RP11-483F11.1
Gene Description ectonucleoside triphosphate diphosphohydrolase 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENTPD7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57089
Iso type IgG

Enviar un mensaje


ENTPD7 polyclonal antibody

ENTPD7 polyclonal antibody