FDCSP polyclonal antibody
  • FDCSP polyclonal antibody

FDCSP polyclonal antibody

Ref: AB-PAB20711
FDCSP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FDCSP.
Información adicional
Size 100 uL
Gene Name FDCSP
Gene Alias UNQ733/PRO1419|C4orf7|FDC-SP
Gene Description follicular dendritic cell secreted protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FDCSP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 260436
Iso type IgG

Enviar un mensaje


FDCSP polyclonal antibody

FDCSP polyclonal antibody