MEGF9 polyclonal antibody
  • MEGF9 polyclonal antibody

MEGF9 polyclonal antibody

Ref: AB-PAB20710
MEGF9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MEGF9.
Información adicional
Size 100 uL
Gene Name MEGF9
Gene Alias EGFL5
Gene Description multiple EGF-like-domains 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MEGF9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1955
Iso type IgG

Enviar un mensaje


MEGF9 polyclonal antibody

MEGF9 polyclonal antibody