TMCC3 polyclonal antibody
  • TMCC3 polyclonal antibody

TMCC3 polyclonal antibody

Ref: AB-PAB20704
TMCC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMCC3.
Información adicional
Size 100 uL
Gene Name TMCC3
Gene Alias KIAA1145
Gene Description transmembrane and coiled-coil domain family 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VNKPKYGSDDECSSGTSGSADSNGNQSFGAGGASTLDSQGKLAVILEELREIKDTQAQLAEDIEALKVQFKREYGFISQTLQEERYRYERLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMCC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57458
Iso type IgG

Enviar un mensaje


TMCC3 polyclonal antibody

TMCC3 polyclonal antibody