CNPY4 polyclonal antibody
  • CNPY4 polyclonal antibody

CNPY4 polyclonal antibody

Ref: AB-PAB20700
CNPY4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNPY4.
Información adicional
Size 100 uL
Gene Name CNPY4
Gene Alias MGC40499|PRAT4B
Gene Description canopy 4 homolog (zebrafish)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDRED
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNPY4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 245812
Iso type IgG

Enviar un mensaje


CNPY4 polyclonal antibody

CNPY4 polyclonal antibody