TMED2 polyclonal antibody
  • TMED2 polyclonal antibody

TMED2 polyclonal antibody

Ref: AB-PAB20694
TMED2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMED2.
Información adicional
Size 100 uL
Gene Name TMED2
Gene Alias FLJ21323|P24A|RNP24
Gene Description transmembrane emp24 domain trafficking protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq DAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEAHQNKLEEMINELAVAMTAVKHEQEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMED2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10959
Iso type IgG

Enviar un mensaje


TMED2 polyclonal antibody

TMED2 polyclonal antibody