SEC62 polyclonal antibody
  • SEC62 polyclonal antibody

SEC62 polyclonal antibody

Ref: AB-PAB20693
SEC62 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC62.
Información adicional
Size 100 uL
Gene Name SEC62
Gene Alias Dtrp1|FLJ32803|HTP1|TLOC1|TP-1
Gene Description SEC62 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC62.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7095
Iso type IgG

Enviar un mensaje


SEC62 polyclonal antibody

SEC62 polyclonal antibody