LRRC55 polyclonal antibody
  • LRRC55 polyclonal antibody

LRRC55 polyclonal antibody

Ref: AB-PAB20692
LRRC55 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC55.
Información adicional
Size 100 uL
Gene Name LRRC55
Gene Alias FLJ45686
Gene Description leucine rich repeat containing 55
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC55.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 219527
Iso type IgG

Enviar un mensaje


LRRC55 polyclonal antibody

LRRC55 polyclonal antibody