DPCR1 polyclonal antibody
  • DPCR1 polyclonal antibody

DPCR1 polyclonal antibody

Ref: AB-PAB20690
DPCR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DPCR1.
Información adicional
Size 100 uL
Gene Name DPCR1
Gene Alias MGC126710|MGC126712|PBLT|bCX105N19.6
Gene Description diffuse panbronchiolitis critical region 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DPCR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 135656
Iso type IgG

Enviar un mensaje


DPCR1 polyclonal antibody

DPCR1 polyclonal antibody