TMEM204 polyclonal antibody
  • TMEM204 polyclonal antibody

TMEM204 polyclonal antibody

Ref: AB-PAB20687
TMEM204 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM204.
Información adicional
Size 100 uL
Gene Name TMEM204
Gene Alias C16orf30|CLP24|FLJ20898|MGC111564
Gene Description transmembrane protein 204
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM204.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79652
Iso type IgG

Enviar un mensaje


TMEM204 polyclonal antibody

TMEM204 polyclonal antibody