NEBL polyclonal antibody
  • NEBL polyclonal antibody

NEBL polyclonal antibody

Ref: AB-PAB20683
NEBL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NEBL.
Información adicional
Size 100 uL
Gene Name NEBL
Gene Alias FLJ53769|LNEBL|MGC119746|MGC119747|bA56H7.1
Gene Description nebulette
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CTELISDIRYKEEFKKSKDKCTFVTDSPMLNHVKNIGAFISEAKYKGTIKADLSNSLYKRMPATIDSVFAGEVTQLQSEVAYKQKHDAAKGFSDYAHMKEPPEVKHAMEVNKHQSNISYRKDVQDTHTYSAELDRPD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NEBL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10529
Iso type IgG

Enviar un mensaje


NEBL polyclonal antibody

NEBL polyclonal antibody