RHBDD1 polyclonal antibody
  • RHBDD1 polyclonal antibody

RHBDD1 polyclonal antibody

Ref: AB-PAB20680
RHBDD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RHBDD1.
Información adicional
Size 100 uL
Gene Name RHBDD1
Gene Alias DKFZp547E052|MGC117258
Gene Description rhomboid domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RHBDD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84236
Iso type IgG

Enviar un mensaje


RHBDD1 polyclonal antibody

RHBDD1 polyclonal antibody