NHLRC3 polyclonal antibody
  • NHLRC3 polyclonal antibody

NHLRC3 polyclonal antibody

Ref: AB-PAB20670
NHLRC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NHLRC3.
Información adicional
Size 100 uL
Gene Name NHLRC3
Gene Alias DKFZp313M1221|DKFZp686E1140
Gene Description NHL repeat containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ILWLHGENGTGPAKFNIPHSVTLDSAGRVWVADRGNKRIQVFDKDTGEWLGAWNNCFTEEGPSSVRFTPDGKYLIVAQLNLSRLSVVAAPPVGSIGECSVISTIQLADQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NHLRC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 387921
Iso type IgG

Enviar un mensaje


NHLRC3 polyclonal antibody

NHLRC3 polyclonal antibody