SPCS2 polyclonal antibody
  • SPCS2 polyclonal antibody

SPCS2 polyclonal antibody

Ref: AB-PAB20654
SPCS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPCS2.
Información adicional
Size 100 uL
Gene Name SPCS2
Gene Alias KIAA0102|MGC117366
Gene Description signal peptidase complex subunit 2 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPCS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9789
Iso type IgG

Enviar un mensaje


SPCS2 polyclonal antibody

SPCS2 polyclonal antibody