GGT7 polyclonal antibody
  • GGT7 polyclonal antibody

GGT7 polyclonal antibody

Ref: AB-PAB20645
GGT7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GGT7.
Información adicional
Size 100 uL
Gene Name GGT7
Gene Alias D20S101|GGT4|GGTL3|GGTL5|dJ18C9.2
Gene Description gamma-glutamyltransferase 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HLVLSPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGHINDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GGT7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2686
Iso type IgG

Enviar un mensaje


GGT7 polyclonal antibody

GGT7 polyclonal antibody