PCDHB5 polyclonal antibody
  • PCDHB5 polyclonal antibody

PCDHB5 polyclonal antibody

Ref: AB-PAB20644
PCDHB5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCDHB5.
Información adicional
Size 100 uL
Gene Name PCDHB5
Gene Alias DKFZp586B0217|PCDH-BETA5
Gene Description protocadherin beta 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HYKGNKELLQLDIKTGNLLLYEKLDREVMCGATEPCILHFQLLLENPVQFFQTDLQLTDINDHAPEFPEKEMLLKIPESTQPGTVFPLKIAQDFDIGSNTVQNY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCDHB5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26167
Iso type IgG

Enviar un mensaje


PCDHB5 polyclonal antibody

PCDHB5 polyclonal antibody