ATP1B1 polyclonal antibody
  • ATP1B1 polyclonal antibody

ATP1B1 polyclonal antibody

Ref: AB-PAB20637
ATP1B1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATP1B1.
Información adicional
Size 100 uL
Gene Name ATP1B1
Gene Alias ATP1B|MGC1798
Gene Description ATPase, Na+/K+ transporting, beta 1 polypeptide
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATP1B1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 481
Iso type IgG

Enviar un mensaje


ATP1B1 polyclonal antibody

ATP1B1 polyclonal antibody