SYT7 polyclonal antibody
  • SYT7 polyclonal antibody

SYT7 polyclonal antibody

Ref: AB-PAB20630
SYT7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYT7.
Información adicional
Size 100 uL
Gene Name SYT7
Gene Alias IPCA-7|MGC150517|PCANAP7|SYT-VII
Gene Description synaptotagmin VII
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NSLETVGTPDSGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLLP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYT7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9066
Iso type IgG

Enviar un mensaje


SYT7 polyclonal antibody

SYT7 polyclonal antibody