C19orf26 polyclonal antibody
  • C19orf26 polyclonal antibody

C19orf26 polyclonal antibody

Ref: AB-PAB20621
C19orf26 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C19orf26.
Información adicional
Size 100 uL
Gene Name C19orf26
Gene Alias DOS|MGC40084
Gene Description chromosome 19 open reading frame 26
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VHQRLNRAMEEAEKTTTTYLDNGTHPAQDPDFRGEDPECQDAETERFLSTSSTGRRVSFNEAALFEQSRKTQDKGRRYTLTEGDFHHLKNARLTHLHLPPLKIVTIHECD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C19orf26.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255057
Iso type IgG

Enviar un mensaje


C19orf26 polyclonal antibody

C19orf26 polyclonal antibody