DACH1 polyclonal antibody
  • DACH1 polyclonal antibody

DACH1 polyclonal antibody

Ref: AB-PAB20612
DACH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DACH1.
Información adicional
Size 100 uL
Gene Name DACH1
Gene Alias DACH|FLJ10138
Gene Description dachshund homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DACH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1602
Iso type IgG

Enviar un mensaje


DACH1 polyclonal antibody

DACH1 polyclonal antibody