PAWR polyclonal antibody
  • PAWR polyclonal antibody

PAWR polyclonal antibody

Ref: AB-PAB20610
PAWR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PAWR.
Información adicional
Size 100 uL
Gene Name PAWR
Gene Alias PAR4|Par-4
Gene Description PRKC, apoptosis, WT1, regulator
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PAWR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5074
Iso type IgG

Enviar un mensaje


PAWR polyclonal antibody

PAWR polyclonal antibody