THSD1 polyclonal antibody
  • THSD1 polyclonal antibody

THSD1 polyclonal antibody

Ref: AB-PAB20606
THSD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant THSD1.
Información adicional
Size 100 uL
Gene Name THSD1
Gene Alias MGC74971|TMTSP|UNQ3010
Gene Description thrombospondin, type I, domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human THSD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55901
Iso type IgG

Enviar un mensaje


THSD1 polyclonal antibody

THSD1 polyclonal antibody