FKBP9 polyclonal antibody
  • FKBP9 polyclonal antibody

FKBP9 polyclonal antibody

Ref: AB-PAB20604
FKBP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FKBP9.
Información adicional
Size 100 uL
Gene Name FKBP9
Gene Alias DKFZp586B1723|FKBP60|FKBP63|MGC126772|MGC138258|PPIase
Gene Description FK506 binding protein 9, 63 kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FKBP9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11328
Iso type IgG

Enviar un mensaje


FKBP9 polyclonal antibody

FKBP9 polyclonal antibody