P11 polyclonal antibody
  • P11 polyclonal antibody

P11 polyclonal antibody

Ref: AB-PAB20598
P11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant P11.
Información adicional
Size 100 uL
Gene Name P11
Gene Alias MGC133268|PP11|PRSS26
Gene Description 26 serine protease
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRY
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human P11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8909
Iso type IgG

Enviar un mensaje


P11 polyclonal antibody

P11 polyclonal antibody