FAM172A polyclonal antibody
  • FAM172A polyclonal antibody

FAM172A polyclonal antibody

Ref: AB-PAB20593
FAM172A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM172A.
Información adicional
Size 100 uL
Gene Name FAM172A
Gene Alias C5orf21|DKFZp564D172
Gene Description family with sequence similarity 172, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq QIQQGGPDEKEKTTALKDLLSRIDLDELMKKDEPPLDFPDTLEGFEYAFNEKGQLRHIKTGEPFVFNYREDLHRWNQKRYEALGEIITKYVYELLEKDCNLKKVSIPVDATESEPKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM172A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83989
Iso type IgG

Enviar un mensaje


FAM172A polyclonal antibody

FAM172A polyclonal antibody