TMEM25 polyclonal antibody
  • TMEM25 polyclonal antibody

TMEM25 polyclonal antibody

Ref: AB-PAB20591
TMEM25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM25.
Información adicional
Size 100 uL
Gene Name TMEM25
Gene Alias FLJ14399
Gene Description transmembrane protein 25
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RKEKKTKGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSQGFIRLPVLGYIYRVSSVSSDEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM25.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84866
Iso type IgG

Enviar un mensaje


TMEM25 polyclonal antibody

TMEM25 polyclonal antibody