JHDM1D polyclonal antibody
  • JHDM1D polyclonal antibody

JHDM1D polyclonal antibody

Ref: AB-PAB20588
JHDM1D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant JHDM1D.
Información adicional
Size 100 uL
Gene Name JHDM1D
Gene Alias KIAA1718
Gene Description jumonji C domain containing histone demethylase 1 homolog D (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human JHDM1D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80853
Iso type IgG

Enviar un mensaje


JHDM1D polyclonal antibody

JHDM1D polyclonal antibody