USP36 polyclonal antibody
  • USP36 polyclonal antibody

USP36 polyclonal antibody

Ref: AB-PAB20583
USP36 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant USP36.
Información adicional
Size 100 uL
Gene Name USP36
Gene Alias DUB1
Gene Description ubiquitin specific peptidase 36
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DSLVHSSNVKVVLNQQAYVLFYLRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPISRNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USP36.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57602
Iso type IgG

Enviar un mensaje


USP36 polyclonal antibody

USP36 polyclonal antibody