LILRB5 polyclonal antibody
  • LILRB5 polyclonal antibody

LILRB5 polyclonal antibody

Ref: AB-PAB20582
LILRB5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LILRB5.
Información adicional
Size 100 uL
Gene Name LILRB5
Gene Alias CD85C|LIR-8|LIR8
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LILRB5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10990
Iso type IgG

Enviar un mensaje


LILRB5 polyclonal antibody

LILRB5 polyclonal antibody