C7orf58 polyclonal antibody
  • C7orf58 polyclonal antibody

C7orf58 polyclonal antibody

Ref: AB-PAB20579
C7orf58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf58.
Información adicional
Size 100 uL
Gene Name C7orf58
Gene Alias FLJ21986|FLJ26813
Gene Description chromosome 7 open reading frame 58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79974
Iso type IgG

Enviar un mensaje


C7orf58 polyclonal antibody

C7orf58 polyclonal antibody