C3orf52 polyclonal antibody
  • C3orf52 polyclonal antibody

C3orf52 polyclonal antibody

Ref: AB-PAB20574
C3orf52 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C3orf52.
Información adicional
Size 100 uL
Gene Name C3orf52
Gene Alias FLJ23186|TTMP
Gene Description chromosome 3 open reading frame 52
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C3orf52.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79669
Iso type IgG

Enviar un mensaje


C3orf52 polyclonal antibody

C3orf52 polyclonal antibody