SORCS1 polyclonal antibody
  • SORCS1 polyclonal antibody

SORCS1 polyclonal antibody

Ref: AB-PAB20572
SORCS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SORCS1.
Información adicional
Size 100 uL
Gene Name SORCS1
Gene Alias FLJ41758|FLJ43475|FLJ44957
Gene Description sortilin-related VPS10 domain containing receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SORCS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 114815
Iso type IgG

Enviar un mensaje


SORCS1 polyclonal antibody

SORCS1 polyclonal antibody