KAZALD1 polyclonal antibody
  • KAZALD1 polyclonal antibody

KAZALD1 polyclonal antibody

Ref: AB-PAB20562
KAZALD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KAZALD1.
Información adicional
Size 100 uL
Gene Name KAZALD1
Gene Alias BONO1|FKSG28|FKSG40|FLJ24094|IGFBP-rP10|bA108L7.1
Gene Description Kazal-type serine peptidase inhibitor domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRFEVTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLRSLNLVPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KAZALD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81621
Iso type IgG

Enviar un mensaje


KAZALD1 polyclonal antibody

KAZALD1 polyclonal antibody