SEZ6 polyclonal antibody
  • SEZ6 polyclonal antibody

SEZ6 polyclonal antibody

Ref: AB-PAB20558
SEZ6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEZ6.
Información adicional
Size 100 uL
Gene Name SEZ6
Gene Alias -
Gene Description seizure related 6 homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEZ6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124925
Iso type IgG

Enviar un mensaje


SEZ6 polyclonal antibody

SEZ6 polyclonal antibody