HEG1 polyclonal antibody
  • HEG1 polyclonal antibody

HEG1 polyclonal antibody

Ref: AB-PAB20555
HEG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HEG1.
Información adicional
Size 100 uL
Gene Name HEG1
Gene Alias HEG|KIAA1237|MGC72175|MST112|MSTP112
Gene Description HEG homolog 1 (zebrafish)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NQEDFSTVSSKEGVMVQTSGKSHAASDAPENLTLLAETADARGRSGSSSRTNFTILPVGYSLEIATALTSQSGNLASESLHLPSSSSEFDERIAAFQTKSGTASEMGTERAMGLSEEWTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HEG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57493
Iso type IgG

Enviar un mensaje


HEG1 polyclonal antibody

HEG1 polyclonal antibody