GALNTL5 polyclonal antibody
  • GALNTL5 polyclonal antibody

GALNTL5 polyclonal antibody

Ref: AB-PAB20537
GALNTL5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GALNTL5.
Información adicional
Size 100 uL
Gene Name GALNTL5
Gene Alias GALNT15
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GALNTL5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 168391
Iso type IgG

Enviar un mensaje


GALNTL5 polyclonal antibody

GALNTL5 polyclonal antibody