CCDC90B polyclonal antibody
  • CCDC90B polyclonal antibody

CCDC90B polyclonal antibody

Ref: AB-PAB20535
CCDC90B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC90B.
Información adicional
Size 100 uL
Gene Name CCDC90B
Gene Alias MDS011|MDS025|MGC104239
Gene Description coiled-coil domain containing 90B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq AHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC90B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 60492
Iso type IgG

Enviar un mensaje


CCDC90B polyclonal antibody

CCDC90B polyclonal antibody