SEMA4C polyclonal antibody
  • SEMA4C polyclonal antibody

SEMA4C polyclonal antibody

Ref: AB-PAB20534
SEMA4C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEMA4C.
Información adicional
Size 100 uL
Gene Name SEMA4C
Gene Alias FLJ20369|KIAA1739|M-SEMA-F|MGC126382|MGC126383|SEMACL1|SEMAF|SEMAI
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFRERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEMA4C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54910
Iso type IgG

Enviar un mensaje


SEMA4C polyclonal antibody

SEMA4C polyclonal antibody