TMIGD2 polyclonal antibody
  • TMIGD2 polyclonal antibody

TMIGD2 polyclonal antibody

Ref: AB-PAB20533
TMIGD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMIGD2.
Información adicional
Size 100 uL
Gene Name TMIGD2
Gene Alias MGC23244
Gene Description transmembrane and immunoglobulin domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMIGD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 126259
Iso type IgG

Enviar un mensaje


TMIGD2 polyclonal antibody

TMIGD2 polyclonal antibody