GAPT polyclonal antibody
  • GAPT polyclonal antibody

GAPT polyclonal antibody

Ref: AB-PAB20531
GAPT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GAPT.
Información adicional
Size 100 uL
Gene Name GAPT
Gene Alias C5orf29|FLJ33641|MGC70478
Gene Description GRB2-binding adaptor protein, transmembrane
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDED
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GAPT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 202309
Iso type IgG

Enviar un mensaje


GAPT polyclonal antibody

GAPT polyclonal antibody