SNN polyclonal antibody
  • SNN polyclonal antibody

SNN polyclonal antibody

Ref: AB-PAB20529
SNN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNN.
Información adicional
Size 100 uL
Gene Name SNN
Gene Alias -
Gene Description stannin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8303
Iso type IgG

Enviar un mensaje


SNN polyclonal antibody

SNN polyclonal antibody