CEACAM1 polyclonal antibody
  • CEACAM1 polyclonal antibody

CEACAM1 polyclonal antibody

Ref: AB-PAB20527
CEACAM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEACAM1.
Información adicional
Size 100 uL
Gene Name CEACAM1
Gene Alias BGP|BGP1|BGPI
Gene Description carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEACAM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 634
Iso type IgG

Enviar un mensaje


CEACAM1 polyclonal antibody

CEACAM1 polyclonal antibody