ZNF782 polyclonal antibody
  • ZNF782 polyclonal antibody

ZNF782 polyclonal antibody

Ref: AB-PAB20525
ZNF782 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF782.
Información adicional
Size 100 uL
Gene Name ZNF782
Gene Alias FLJ16636
Gene Description zinc finger protein 782
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QSTFSVHQKVHIRAKPYEYNECGKSCSMNSHLIWPQKSHTGEKPYECPECGKAFSEKSRLRKHQRTHTGEKPYKCDGCDKAFSAKSGLRIHQRTHTGEKPFECHECGKSFNYKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF782.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158431
Iso type IgG

Enviar un mensaje


ZNF782 polyclonal antibody

ZNF782 polyclonal antibody