CCDC67 polyclonal antibody
  • CCDC67 polyclonal antibody

CCDC67 polyclonal antibody

Ref: AB-PAB20522
CCDC67 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC67.
Información adicional
Size 100 uL
Gene Name CCDC67
Gene Alias FLJ25393
Gene Description coiled-coil domain containing 67
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQTHLISLDAQQKLLSEKCNQFQKQAQSYQTQLNGKKQCLEDSSSEIPRLICDPDPNCEINERDEFIIEKLKSAVNEIALSRNKLQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC67.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 159989
Iso type IgG

Enviar un mensaje


CCDC67 polyclonal antibody

CCDC67 polyclonal antibody